SCOPe 2.06: Domain d3wtgb_: 3wtg B:

Lineage for d3wtgb_ (3wtg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Dromaius novaehollandiae [TaxId:8790] [258618] (1 PDB entry)

8. Domain d3wtgb_: 3wtg B: [258620]
   automated match to d3fs4b_
   complexed with hem, oxy

Details for d3wtgb_

PDB Entry: 3wtg, 2.3 Å

PDB Description: Crystal structure of Emu (dromaius novaehollandiae) hemoglobin at 2.3 angstrom resolution

PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d3wtgb_:

Sequence; same for both SEQRES and ATOM records:

>d3wtgb_ a.1.1.2 (B:) automated matches {Dromaius novaehollandiae [TaxId: 8790]}
vqwsaeekqlisslwgkvnvaecgaealarllivypwtqrfftsfgnlssasaiignpmv
rahgkkvltsfgdavknldnikntfaqlselhcdklhvdpenfrllgdiliivlaahfak
eftpecqaawqklvrvvahalarkyh

Timeline for d3wtgb_:

• d3wtgb_ first appeared in SCOPe 2.04
  
• d3wtgb_ appears in SCOPe 2.05
  
• d3wtgb_ appears in SCOPe 2.07
  
• d3wtgb_ appears in the current release, SCOPe 2.08