Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Aeromonas jandaei [TaxId:650] [258594] (2 PDB entries) |
Domain d3wgbb_: 3wgb B: [258601] automated match to d2fm1d_ complexed with gly, plg |
PDB Entry: 3wgb (more details), 2.6 Å
SCOPe Domain Sequences for d3wgbb_:
Sequence, based on SEQRES records: (download)
>d3wgbb_ c.67.1.0 (B:) automated matches {Aeromonas jandaei [TaxId: 650]} yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqadgslaladvraai apddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasght vrelvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglf alqqhvvrladdhrrarqlaeglaalpgirldlaqvqtnmvflqltsgesapllafmkar gilfsgygelrlvthlqihdddieevidaftey
>d3wgbb_ c.67.1.0 (B:) automated matches {Aeromonas jandaei [TaxId: 650]} yidlrsdtvtqptdamrqcmlhaevgddvygedpgvnaleaygadllgkeaalfvpsgtm snllavmshcqrgegavlgsaahiyryeaqgsavlgsvalqpvpmqdgslaladvraaia ddvhftptrlvclenthngkvlplpylremrelvdehglqlhldgarlfnavvasghtvr elvapfdsvsiclskglgapvgsllvgshafiararrlrkmvgggmrqagilaqaglfal qqhvvrladdhrrarqlaeglaalrldlaqvqtnmvflqlpllafmkargilfsglrlvt hlqihdddieevidaftey
Timeline for d3wgbb_: