| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein Trypsin(ogen) [50515] (9 species) |
| Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries) Uniprot P00760 |
| Domain d1tawa_: 1taw A: [25860] Other proteins in same PDB: d1tawb_ complexed with ca |
PDB Entry: 1taw (more details), 1.8 Å
SCOPe Domain Sequences for d1tawa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tawa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilstsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1tawa_: