Lineage for d3wexc1 (3wex C:1-82)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183697Domain d3wexc1: 3wex C:1-82 [258592]
    Other proteins in same PDB: d3wexa2, d3wexc2, d3wexe2, d3wexg2
    automated match to d1f3ja2
    complexed with nag

Details for d3wexc1

PDB Entry: 3wex (more details), 2.4 Å

PDB Description: crystal structure of hla-dp5 in complex with cry j 1-derived peptide (residues 214-222)
PDB Compounds: (C:) MHC class II antigen

SCOPe Domain Sequences for d3wexc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wexc1 d.19.1.0 (C:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikadhvstyamfvqthrptgefmfefdedeqfyvdldkketvwhleefgrafsfeaqggl
aniailnnnlntliqrsnhtqa

SCOPe Domain Coordinates for d3wexc1:

Click to download the PDB-style file with coordinates for d3wexc1.
(The format of our PDB-style files is described here.)

Timeline for d3wexc1: