SCOPe 2.04: Domain d3wd6c1: 3wd6 C:10-108

Lineage for d3wd6c1 (3wd6 C:10-108)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (8 PDB entries)

8. Domain d3wd6c1: 3wd6 C:10-108 [258580]
   Other proteins in same PDB: d3wd6b2, d3wd6c2, d3wd6d2
   automated match to d3qaga1
   complexed with edo, gsh, iod, k, peg

Details for d3wd6c1

PDB Entry: 3wd6, 2.5 Å

PDB Description: Crystal structure of Bombyx mori omega-class glutathione transferase in complex with GSH

PDB Compounds: (C:) Omega-class glutathione S-transferase

SCOPe Domain Sequences for d3wd6c1:

Sequence; same for both SEQRES and ATOM records:

>d3wd6c1 c.47.1.0 (C:10-108) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
infntkhlrkgdplppfngklrvynmrycpyaqrtilalnakqidyevvnidlidkpewl
ttksafakvpaieiaedvtiyeslvtveyldevypkrpl

Timeline for d3wd6c1:

• d3wd6c1 is new in SCOPe 2.04-stable
  
• d3wd6c1 appears in SCOPe 2.05
  
• d3wd6c1 appears in the current release, SCOPe 2.08