SCOPe 2.04: Domain d4qo8b2: 4qo8 B:160-331

Lineage for d4qo8b2 (4qo8 B:160-331)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (7 PDB entries)

8. Domain d4qo8b2: 4qo8 B:160-331 [258489]
   Other proteins in same PDB: d4qo8a1, d4qo8b1, d4qo8c1, d4qo8d1
   automated match to d1i10a2
   complexed with 36u, epe, lac, nai, so4

Details for d4qo8b2

PDB Entry: 4qo8, 2 Å

PDB Description: Lactate Dehydrogenase A in complex with substituted 3-Hydroxy-2-mercaptocyclohex-2-enone compound 104

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4qo8b2:

Sequence; same for both SEQRES and ATOM records:

>d4qo8b2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d4qo8b2:

• d4qo8b2 is new in SCOPe 2.04-stable
  
• d4qo8b2 appears in SCOPe 2.05
  
• d4qo8b2 appears in the current release, SCOPe 2.08