Lineage for d4qo7b1 (4qo7 B:1-159)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829467Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (13 PDB entries)
  8. 1829491Domain d4qo7b1: 4qo7 B:1-159 [258488]
    Other proteins in same PDB: d4qo7a2, d4qo7b2, d4qo7c2, d4qo7d2
    automated match to d1i10a1
    complexed with 2op, 36v, epe, nai, so4

Details for d4qo7b1

PDB Entry: 4qo7 (more details), 2.14 Å

PDB Description: Lactate Dehydrogenase A in complex with substituted 3-Hydroxy-2-mercaptocyclohex-2-enone compound 7
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4qo7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qo7b1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4qo7b1:

Click to download the PDB-style file with coordinates for d4qo7b1.
(The format of our PDB-style files is described here.)

Timeline for d4qo7b1: