Lineage for d4qn6a_ (4qn6 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (9 species) 
Species Influenza A virus (a/chicken/nanchang/7-010/2000(h3n6)) [TaxId:215864] [311106] (2 PDB entries) 
Domain d4qn6a_: 4qn6 A: [258473]
automated match to d1v0za_
complexed with ca, lnv
Details for d4qn6a_
PDB Entry: 4qn6 (more details), 1.95 Å
PDB Description: crystal structure of neuraminidase n6 complexed with laninamivir
PDB Compounds: (A:) NeuraminidaseSCOPe Domain Sequences for d4qn6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qn6a_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus (a/chicken/nanchang/7-010/2000(h3n6)) [TaxId: 215864]}
gtflnltkplcevsswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspynvrvecigwsstschdgisrmsicmsgpnnn
asavvwyggrpvteipswagnilrtqesecvchkgicpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygavgvikcvcrdnwkganrpvitidpemmthtskylcsk
iltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdtqsgpishqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskerlgswswhdgaeiiyfk
SCOPe Domain Coordinates for d4qn6a_:
Click to download the PDB-style file with coordinates for d4qn6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qn6a_:
- d4qn6a_ first appeared in SCOPe 2.04
- d4qn6a_ appears in SCOPe 2.07
View in 3D
