Lineage for d4qlsq_ (4qls Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228917Domain d4qlsq_: 4qls Q: [258453]
    Other proteins in same PDB: d4qlsa_, d4qlsb_, d4qlse_, d4qlsg_, d4qlsi_, d4qlsj_, d4qlsk_, d4qlsl_, d4qlsn_, d4qlso_, d4qlss_, d4qlsu_, d4qlsw_, d4qlsx_, d4qlsy_, d4qlsz_
    automated match to d1rypd_
    complexed with 37y, mes, mg

Details for d4qlsq_

PDB Entry: 4qls (more details), 2.8 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 11
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qlsq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlsq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qlsq_:

Click to download the PDB-style file with coordinates for d4qlsq_.
(The format of our PDB-style files is described here.)

Timeline for d4qlsq_: