Lineage for d4qlvj_ (4qlv J:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1678042Domain d4qlvj_: 4qlv J: [258431]
    Other proteins in same PDB: d4qlvc_, d4qlvd_, d4qlvg_, d4qlvq_, d4qlvr_, d4qlvu_
    automated match to d1rypk_
    complexed with 39q, mes, mg

Details for d4qlvj_

PDB Entry: 4qlv (more details), 2.9 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 17
PDB Compounds: (J:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qlvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlvj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d4qlvj_:

Click to download the PDB-style file with coordinates for d4qlvj_.
(The format of our PDB-style files is described here.)

Timeline for d4qlvj_: