Lineage for d4qlvd_ (4qlv D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936790Domain d4qlvd_: 4qlv D: [258428]
    Other proteins in same PDB: d4qlva_, d4qlvb_, d4qlve_, d4qlvg_, d4qlvi_, d4qlvj_, d4qlvk_, d4qlvl_, d4qlvn_, d4qlvo_, d4qlvs_, d4qlvu_, d4qlvw_, d4qlvx_, d4qlvy_, d4qlvz_
    automated match to d1rype_
    complexed with 39q, mes, mg

Details for d4qlvd_

PDB Entry: 4qlv (more details), 2.9 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 17
PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d4qlvd_:

Sequence, based on SEQRES records: (download)

>d4qlvd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d4qlvd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d4qlvd_:

Click to download the PDB-style file with coordinates for d4qlvd_.
(The format of our PDB-style files is described here.)

Timeline for d4qlvd_: