Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4qluq_: 4qlu Q: [258419] Other proteins in same PDB: d4qlua_, d4qlub_, d4qlue_, d4qlug_, d4qlui_, d4qluj_, d4qluk_, d4qlul_, d4qlun_, d4qluo_, d4qlus_, d4qluu_, d4qluw_, d4qlux_, d4qluy_, d4qluz_ automated match to d1rypd_ complexed with 38x, mes, mg |
PDB Entry: 4qlu (more details), 2.8 Å
SCOPe Domain Sequences for d4qluq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qluq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qluq_: