Lineage for d4qluq_ (4qlu Q:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936845Domain d4qluq_: 4qlu Q: [258419]
    Other proteins in same PDB: d4qlua_, d4qlub_, d4qlue_, d4qlug_, d4qlui_, d4qluj_, d4qluk_, d4qlul_, d4qlun_, d4qluo_, d4qlus_, d4qluu_, d4qluw_, d4qlux_, d4qluy_, d4qluz_
    automated match to d1rypd_
    complexed with 38x, mes, mg

Details for d4qluq_

PDB Entry: 4qlu (more details), 2.8 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 9
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qluq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qluq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qluq_:

Click to download the PDB-style file with coordinates for d4qluq_.
(The format of our PDB-style files is described here.)

Timeline for d4qluq_: