Lineage for d4qlqb_ (4qlq b:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677596Domain d4qlqb_: 4qlq b: [258405]
    Other proteins in same PDB: d4qlqc_, d4qlqd_, d4qlqg_, d4qlqq_, d4qlqr_, d4qlqu_
    automated match to d1g0un_
    complexed with 38n, mes, mg

Details for d4qlqb_

PDB Entry: 4qlq (more details), 2.4 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 8
PDB Compounds: (b:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d4qlqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qlqb_ d.153.1.4 (b:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d4qlqb_:

Click to download the PDB-style file with coordinates for d4qlqb_.
(The format of our PDB-style files is described here.)

Timeline for d4qlqb_: