SCOPe 2.04: Domain d4qaca_: 4qac A:

Lineage for d4qaca_ (4qac A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein
7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (11 PDB entries)

8. Domain d4qaca_: 4qac A: [258336]
   automated match to d4alxa_
   complexed with kk3, nag, po4

Details for d4qaca_

PDB Entry: 4qac, 2.1 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl) pyrimidin-2-amine

PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qaca_:

Sequence, based on SEQRES records:

>d4qaca_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
ildvtqkknsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records):

>d4qaca_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildv
tqkknsvtysccpeayedvevslnfrkkg

Timeline for d4qaca_:

• d4qaca_ is new in SCOPe 2.04-stable
  
• d4qaca_ appears in SCOPe 2.05
  
• d4qaca_ appears in the current release, SCOPe 2.08, called d4qaca1