SCOPe 2.08: Domain d4q7ua1: 4q7u A:6-224

Lineage for d4q7ua1 (4q7u A:6-224)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [258320] (6 PDB entries)

8. Domain d4q7ua1: 4q7u A:6-224 [258321]
   Other proteins in same PDB: d4q7ua2
   automated match to d3ztfa_
   complexed with gol

Details for d4q7ua1

PDB Entry: 4q7u, 1.3 Å

PDB Description: Crystal structure of photoswitchable fluorescent protein PSmOrange2

PDB Compounds: (A:) PSmOrange2

SCOPe Domain Sequences for d4q7ua1:

Sequence; same for both SEQRES and ATOM records:

>d4q7ua1 d.22.1.0 (A:6-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvhmegtvnghefeiegegeghpyegfqtaklkvtkggplpfawdilsplx
skayvkhpadipdyfklsfpegfkwervmnyedggvvtvtqdsslqdgefiykvkmrgtn
fpsdgpvmqkktmgweassermypedgalkgeirmrlklkdgghytsevkttykakksvl
lpgayivgiklditshnedytiveqyersearhstg

Timeline for d4q7ua1:

• d4q7ua1 first appeared in SCOPe 2.04, called d4q7ua_
  
• d4q7ua1 appears in SCOPe 2.07