SCOPe 2.04: Domain d4q5ec_: 4q5e C:

Lineage for d4q5ec_ (4q5e C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (11 PDB entries)

8. Domain d4q5ec_: 4q5e C: [258311]
   Other proteins in same PDB: d4q5eb_
   automated match to d1wzva1

Details for d4q5ec_

PDB Entry: 4q5e, 1.87 Å

PDB Description: shigella effector kinase ospg bound to e2-ub ubch7-ub conjugate

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d4q5ec_:

Sequence; same for both SEQRES and ATOM records:

>d4q5ec_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpa
eypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpeh
plradlaeeyskdrkkfsknaeeftkkygekrpvd

Timeline for d4q5ec_:

• d4q5ec_ is new in SCOPe 2.04-stable
  
• d4q5ec_ appears in SCOPe 2.05
  
• d4q5ec_ appears in the current release, SCOPe 2.08, called d4q5ec1