Lineage for d4q0xl1 (4q0x L:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2025003Domain d4q0xl1: 4q0x L:1-112 [258284]
    Other proteins in same PDB: d4q0xl2
    automated match to d2ok0l1

Details for d4q0xl1

PDB Entry: 4q0x (more details), 2.9 Å

PDB Description: Crystal structure of non-neutralizing antibody in complex with Epitope II of HCV E2
PDB Compounds: (L:) mAb 12 light chain

SCOPe Domain Sequences for d4q0xl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q0xl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhnngntyldwslqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

SCOPe Domain Coordinates for d4q0xl1:

Click to download the PDB-style file with coordinates for d4q0xl1.
(The format of our PDB-style files is described here.)

Timeline for d4q0xl1: