Lineage for d4q1su_ (4q1s U:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1676731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (66 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1676953Domain d4q1su_: 4q1s U: [258275]
    Other proteins in same PDB: d4q1sa_, d4q1sb_, d4q1sc_, d4q1sd_, d4q1sf_, d4q1si_, d4q1sj_, d4q1sk_, d4q1sl_, d4q1sm_, d4q1sn_, d4q1so_, d4q1sq_, d4q1sr_, d4q1sw_, d4q1sx_, d4q1sy_, d4q1sz_
    automated match to d1g0ug_
    complexed with 2yd

Details for d4q1su_

PDB Entry: 4q1s (more details), 2.6 Å

PDB Description: Yeast 20S proteasome in Complex with Kendomycin
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4q1su_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1su_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d4q1su_:

Click to download the PDB-style file with coordinates for d4q1su_.
(The format of our PDB-style files is described here.)

Timeline for d4q1su_: