Lineage for d4q1sm_ (4q1s M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (197 PDB entries)
  8. 2553047Domain d4q1sm_: 4q1s M: [258272]
    Other proteins in same PDB: d4q1sa_, d4q1sb_, d4q1se_, d4q1sg_, d4q1si_, d4q1sj_, d4q1sk_, d4q1sl_, d4q1sn_, d4q1so_, d4q1ss_, d4q1su_, d4q1sw_, d4q1sx_, d4q1sy_, d4q1sz_
    automated match to d4j70m_
    complexed with 2yd

Details for d4q1sm_

PDB Entry: 4q1s (more details), 2.6 Å

PDB Description: Yeast 20S proteasome in Complex with Kendomycin
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4q1sm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1sm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d4q1sm_:

Click to download the PDB-style file with coordinates for d4q1sm_.
(The format of our PDB-style files is described here.)

Timeline for d4q1sm_: