SCOPe 2.04: Domain d4psxd_: 4psx D:

Lineage for d4psxd_ (4psx D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Histone acetyltransferase HAT1 [55742] (2 species)
   contains additional N- and C-terminal (sub)domains

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55743] (3 PDB entries)

8. Domain d4psxd_: 4psx D: [258235]
   automated match to d1boba_
   complexed with coa, so4

Details for d4psxd_

PDB Entry: 4psx, 2.51 Å

PDB Description: Crystal structure of histone acetyltransferase complex

PDB Compounds: (D:) Histone acetyltransferase type B catalytic subunit

SCOPe Domain Sequences for d4psxd_:

Sequence; same for both SEQRES and ATOM records:

>d4psxd_ d.108.1.1 (D:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkpy
vnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvse
yslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktke
ligfvttykywhylgaksfdedidkkfrakisqflifppyqnkghgsclyeaiiqswled
ksiteitvedpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleerq
fnrlvemllllnn

Timeline for d4psxd_:

• d4psxd_ is new in SCOPe 2.04-stable
  
• d4psxd_ appears in SCOPe 2.05
  
• d4psxd_ appears in the current release, SCOPe 2.08