Lineage for d4pj9d1 (4pj9 D:2-114)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765518Domain d4pj9d1: 4pj9 D:2-114 [258224]
    Other proteins in same PDB: d4pj9a1, d4pj9b_, d4pj9c2
    automated match to d2axhb1
    complexed with 2lj, gol, na

Details for d4pj9d1

PDB Entry: 4pj9 (more details), 2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait traj20 tcr
PDB Compounds: (D:) TCR-beta

SCOPe Domain Sequences for d4pj9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj9d1 b.1.1.0 (D:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevp
dgysvsrantddfpltlasavpsqtsvyfcassagastgelffgegsrltvle

SCOPe Domain Coordinates for d4pj9d1:

Click to download the PDB-style file with coordinates for d4pj9d1.
(The format of our PDB-style files is described here.)

Timeline for d4pj9d1: