SCOPe 2.08: Domain d4pkhi1: 4pkh I:5-146

Lineage for d4pkhi1 (4pkh I:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d4pkhi1: 4pkh I:5-146 [258218]
   Other proteins in same PDB: d4pkhe_, d4pkhj_
   automated match to d1esva1
   complexed with adp, ca

Details for d4pkhi1

PDB Entry: 4pkh, 2.15 Å

PDB Description: complex of adp-actin with the n-terminal actin-binding domain of tropomodulin

PDB Compounds: (I:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4pkhi1:

Sequence, based on SEQRES records:

>d4pkhi1 c.55.1.1 (I:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d4pkhi1 c.55.1.1 (I:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

Timeline for d4pkhi1:

• d4pkhi1 first appeared in SCOPe 2.04
  
• d4pkhi1 appears in SCOPe 2.07