Lineage for d4pkhd1 (4pkh D:5-146)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137196Protein Actin [53073] (8 species)
  7. 2137222Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (63 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 2137343Domain d4pkhd1: 4pkh D:5-146 [258213]
    Other proteins in same PDB: d4pkhe_, d4pkhj_
    automated match to d1esva1
    complexed with adp, ca

Details for d4pkhd1

PDB Entry: 4pkh (more details), 2.15 Å

PDB Description: complex of adp-actin with the n-terminal actin-binding domain of tropomodulin
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4pkhd1:

Sequence, based on SEQRES records: (download)

>d4pkhd1 c.55.1.1 (D:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4pkhd1 c.55.1.1 (D:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

SCOPe Domain Coordinates for d4pkhd1:

Click to download the PDB-style file with coordinates for d4pkhd1.
(The format of our PDB-style files is described here.)

Timeline for d4pkhd1: