Lineage for d4pkga2 (4pkg A:147-375)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605038Protein Actin [53073] (7 species)
  7. 1605064Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (61 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1605108Domain d4pkga2: 4pkg A:147-375 [258212]
    automated match to d1esva2
    complexed with atp, ca

Details for d4pkga2

PDB Entry: 4pkg (more details), 1.8 Å

PDB Description: complex of atp-actin with the n-terminal actin-binding domain of tropomodulin
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4pkga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkga2 c.55.1.1 (A:147-375) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf

SCOPe Domain Coordinates for d4pkga2:

Click to download the PDB-style file with coordinates for d4pkga2.
(The format of our PDB-style files is described here.)

Timeline for d4pkga2: