Lineage for d4pj7f1 (4pj7 F:3-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367277Domain d4pj7f1: 4pj7 F:3-113 [258204]
    Other proteins in same PDB: d4pj7a1, d4pj7a3, d4pj7b_, d4pj7c1, d4pj7c3, d4pj7d_, d4pj7e2, d4pj7g2
    automated match to d3q5ya1
    complexed with 2lj

Details for d4pj7f1

PDB Entry: 4pj7 (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pj7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj7f1 b.1.1.0 (F:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevpd
gysvsrantddfpltlasavpsqtsvyfcassggtnneqffgpgtrltvle

SCOPe Domain Coordinates for d4pj7f1:

Click to download the PDB-style file with coordinates for d4pj7f1.
(The format of our PDB-style files is described here.)

Timeline for d4pj7f1: