SCOPe 2.04: Domain d4pj7e1: 4pj7 E:1-110

Lineage for d4pj7e1 (4pj7 E:1-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4pj7e1: 4pj7 E:1-110 [258201]
   Other proteins in same PDB: d4pj7b_, d4pj7d_, d4pj7e2
   automated match to d2f54d1
   complexed with 2lj

Details for d4pj7e1

PDB Entry: 4pj7, 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait trbv6-4 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pj7e1:

Sequence; same for both SEQRES and ATOM records:

>d4pj7e1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavmdsnyqliwgagtkliikpd

Timeline for d4pj7e1:

• d4pj7e1 is new in SCOPe 2.04-stable
  
• d4pj7e1 appears in SCOPe 2.05
  
• d4pj7e1 appears in the current release, SCOPe 2.08