Lineage for d4pjhe2 (4pjh E:111-199)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029398Domain d4pjhe2: 4pjh E:111-199 [258191]
    Other proteins in same PDB: d4pjha1, d4pjha2, d4pjhb1, d4pjhb2, d4pjhc1, d4pjhc2, d4pjhd1, d4pjhd2, d4pjhe1, d4pjhf1, d4pjhg1, d4pjhh1
    automated match to d2f54d2
    complexed with 30w, gol, na

Details for d4pjhe2

PDB Entry: 4pjh (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-g8 tcr
PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjhe2:

Sequence, based on SEQRES records: (download)

>d4pjhe2 b.1.1.2 (E:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4pjhe2 b.1.1.2 (E:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snkfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4pjhe2:

Click to download the PDB-style file with coordinates for d4pjhe2.
(The format of our PDB-style files is described here.)

Timeline for d4pjhe2: