SCOPe 2.05: Domain d4pjbh2: 4pjb H:117-240

Lineage for d4pjbh2 (4pjb H:117-240)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4pjbh2: 4pjb H:117-240 [258173]
   Other proteins in same PDB: d4pjba1, d4pjba2, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1
   automated match to d3of6b2
   complexed with 2lj, gol

Details for d4pjbh2

PDB Entry: 4pjb, 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjbh2:

Sequence; same for both SEQRES and ATOM records:

>d4pjbh2 b.1.1.2 (H:117-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeaw

Timeline for d4pjbh2:

• d4pjbh2 first appeared in SCOPe 2.04
  
• d4pjbh2 appears in SCOPe 2.06
  
• d4pjbh2 appears in the current release, SCOPe 2.08