SCOPe 2.05: Domain d4pjcf2: 4pjc F:117-241

Lineage for d4pjcf2 (4pjc F:117-241)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4pjcf2: 4pjc F:117-241 [258166]
   Other proteins in same PDB: d4pjca1, d4pjca2, d4pjcb_, d4pjcc1, d4pjcc2, d4pjcd_, d4pjce1, d4pjcf1, d4pjcg1, d4pjch1
   automated match to d3of6b2
   complexed with 2lj, b3p

Details for d4pjcf2

PDB Entry: 4pjc, 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-a11 tcr

PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjcf2:

Sequence; same for both SEQRES and ATOM records:

>d4pjcf2 b.1.1.2 (F:117-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawg

Timeline for d4pjcf2:

• d4pjcf2 first appeared in SCOPe 2.04
  
• d4pjcf2 appears in SCOPe 2.06
  
• d4pjcf2 appears in the current release, SCOPe 2.08