Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4pjcf2: 4pjc F:117-241 [258166] Other proteins in same PDB: d4pjca1, d4pjca2, d4pjcb_, d4pjcc1, d4pjcc2, d4pjcd_, d4pjce1, d4pjcf1, d4pjcg1, d4pjch1 automated match to d3of6b2 complexed with 2lj, b3p |
PDB Entry: 4pjc (more details), 2.5 Å
SCOPe Domain Sequences for d4pjcf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjcf2 b.1.1.2 (F:117-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawg
Timeline for d4pjcf2: