Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d4pjih1: 4pji H:3-115 [258160] Other proteins in same PDB: d4pjib_, d4pjid_, d4pjie2, d4pjih2 automated match to d3of6c1 complexed with 30w, gol, na |
PDB Entry: 4pji (more details), 2.5 Å
SCOPe Domain Sequences for d4pjih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjih1 b.1.1.0 (H:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn gynvsrlnkrefslrlesaapsqtsvyfcassppggtdtqyfgegsrltvled
Timeline for d4pjih1:
View in 3D Domains from other chains: (mouse over for more information) d4pjib_, d4pjid_, d4pjie1, d4pjie2 |