Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4pjah1: 4pja H:3-115 [258158] Other proteins in same PDB: d4pjaa1, d4pjaa3, d4pjab_, d4pjac1, d4pjac3, d4pjad_, d4pjae2, d4pjaf2, d4pjag2, d4pjah2 automated match to d3of6c1 complexed with 2lj, gol |
PDB Entry: 4pja (more details), 2.68 Å
SCOPe Domain Sequences for d4pjah1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjah1 b.1.1.0 (H:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn gynvsrlnkrefslrlesaapsqtsvyfcastlgqegqpqhfgegsrltvled
Timeline for d4pjah1: