Lineage for d4pjag2 (4pja G:111-198)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517761Domain d4pjag2: 4pja G:111-198 [258155]
    Other proteins in same PDB: d4pjaa1, d4pjaa2, d4pjab_, d4pjad_, d4pjag1, d4pjah1
    automated match to d2f54d2
    complexed with 2lj, gol

Details for d4pjag2

PDB Entry: 4pja (more details), 2.68 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjag2:

Sequence, based on SEQRES records: (download)

>d4pjag2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4pjag2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsndfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4pjag2:

Click to download the PDB-style file with coordinates for d4pjag2.
(The format of our PDB-style files is described here.)

Timeline for d4pjag2: