Lineage for d4pjaa1 (4pja A:0-178)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1642705Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1642706Protein automated matches [226842] (4 species)
    not a true protein
  7. 1642719Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries)
  8. 1642750Domain d4pjaa1: 4pja A:0-178 [258147]
    Other proteins in same PDB: d4pjaa2, d4pjab_, d4pjad_, d4pjag1, d4pjag2, d4pjah1, d4pjah2
    automated match to d4l4ta1
    complexed with 2lj, gol

Details for d4pjaa1

PDB Entry: 4pja (more details), 2.68 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-b10 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjaa1 d.19.1.0 (A:0-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhw
erytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdf
lifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjaa1:

Click to download the PDB-style file with coordinates for d4pjaa1.
(The format of our PDB-style files is described here.)

Timeline for d4pjaa1: