SCOPe 2.05: Domain d4pgha1: 4pgh A:9-116

Lineage for d4pgha1 (4pgh A:9-116)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries)

8. Domain d4pgha1: 4pgh A:9-116 [258140]
   Other proteins in same PDB: d4pgha2, d4pghb2, d4pghc2, d4pghd2
   automated match to d3p9id1
   complexed with sam

Details for d4pgha1

PDB Entry: 4pgh, 2.8 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor

PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pgha1:

Sequence; same for both SEQRES and ATOM records:

>d4pgha1 a.4.5.0 (A:9-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
aavadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpvaptn
paaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne

Timeline for d4pgha1:

• d4pgha1 first appeared in SCOPe 2.04
  
• d4pgha1 appears in SCOPe 2.06
  
• d4pgha1 appears in the current release, SCOPe 2.08