Lineage for d4pghb2 (4pgh B:117-362)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1613107Species Sorghum bicolor [TaxId:4558] [258130] (2 PDB entries)
  8. 1613111Domain d4pghb2: 4pgh B:117-362 [258139]
    Other proteins in same PDB: d4pgha1, d4pghb1
    automated match to d3p9ca2
    complexed with sam

Details for d4pghb2

PDB Entry: 4pgh (more details), 2.8 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor
PDB Compounds: (B:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pghb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pghb2 c.66.1.0 (B:117-362) automated matches {Sorghum bicolor [TaxId: 4558]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmtafeyhgtdprfnrvfneg
mknhsviitkkllefytgfdesvstlvdvgggigatlhaitshhshirgvnfdlphvise
appfpgvqhvggdmfksvpagdailmkwilhdwsdahcatllkncydalpekggkvivve
cvlpvttdavpkaqgvfhvdmimlahnpggreryerefrdlakaagfsgfkatyiyanaw
aiefik

SCOPe Domain Coordinates for d4pghb2:

Click to download the PDB-style file with coordinates for d4pghb2.
(The format of our PDB-style files is described here.)

Timeline for d4pghb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pghb1