SCOPe 2.05: Domain d4pb9l2: 4pb9 L:108-214

Lineage for d4pb9l2 (4pb9 L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4pb9l2: 4pb9 L:108-214 [258117]
   Other proteins in same PDB: d4pb9l1
   automated match to d1h3pl2
   complexed with so4

Details for d4pb9l2

PDB Entry: 4pb9, 2.6 Å

PDB Description: structure of the fab fragment of the anti-francisella tularensis groel antibody ab64

PDB Compounds: (L:) Ab64 light chain

SCOPe Domain Sequences for d4pb9l2:

Sequence, based on SEQRES records:

>d4pb9l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d4pb9l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidrqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4pb9l2:

• d4pb9l2 first appeared in SCOPe 2.04
  
• d4pb9l2 appears in SCOPe 2.06
  
• d4pb9l2 appears in the current release, SCOPe 2.08