Lineage for d4p6ra_ (4p6r A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496574Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 1496575Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 1496638Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 1496639Protein automated matches [254708] (1 species)
    not a true protein
  7. 1496640Species Bacillus megaterium [TaxId:1404] [255981] (15 PDB entries)
  8. 1496651Domain d4p6ra_: 4p6r A: [258097]
    automated match to d4j6vb_
    complexed with tyr, zn

Details for d4p6ra_

PDB Entry: 4p6r (more details), 2.2 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with tyrosine in the active site
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d4p6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p6ra_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

SCOPe Domain Coordinates for d4p6ra_:

Click to download the PDB-style file with coordinates for d4p6ra_.
(The format of our PDB-style files is described here.)

Timeline for d4p6ra_: