Lineage for d4p5oa1 (4p5o A:416-686)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020268Fold e.40: Cullin homology domain [75631] (1 superfamily)
    3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like
  4. 3020269Superfamily e.40.1: Cullin homology domain [75632] (1 family) (S)
  5. 3020270Family e.40.1.1: Cullin homology domain [75633] (2 proteins)
  6. 3020271Protein Cullin homolog 1, cul-1 [75634] (1 species)
  7. 3020272Species Human (Homo sapiens) [TaxId:9606] [75635] (4 PDB entries)
    Uniprot Q13616 17-776
  8. 3020275Domain d4p5oa1: 4p5o A:416-686 [258092]
    Other proteins in same PDB: d4p5oa2, d4p5ob_, d4p5oc2, d4p5od_, d4p5og1, d4p5og2, d4p5og3, d4p5oh_, d4p5oi1, d4p5oi2, d4p5oi3, d4p5ok_
    automated match to d1ldja3
    complexed with zn

Details for d4p5oa1

PDB Entry: 4p5o (more details), 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action
PDB Compounds: (A:) Cullin-1

SCOPe Domain Sequences for d4p5oa1:

Sequence, based on SEQRES records: (download)

>d4p5oa1 e.40.1.1 (A:416-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]}
skspeelarycdsllkkssknpeeaeledtlnqvmekfkkiedkdvfqkfyakmlakrlv
hqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepldldf
siqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelvtncf
knrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllvleden
anvdevelkpdtliklylgyknkklrvninv

Sequence, based on observed residues (ATOM records): (download)

>d4p5oa1 e.40.1.1 (A:416-686) Cullin homolog 1, cul-1 {Human (Homo sapiens) [TaxId: 9606]}
skspeelarycdsllkkssknpeeaeledtlnqvmekfkkiedkdvfqkfyakmlakrlv
hqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsepldldf
siqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgelvtncf
knrytlqastfqmaillytvqqltdstqikmdilaqvlqillksklpdtlirvninv

SCOPe Domain Coordinates for d4p5oa1:

Click to download the PDB-style file with coordinates for d4p5oa1.
(The format of our PDB-style files is described here.)

Timeline for d4p5oa1: