SCOPe 2.04: Domain d4p4ke2: 4p4k E:84-181

Lineage for d4p4ke2 (4p4k E:84-181)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4p4ke2: 4p4k E:84-181 [258085]
   Other proteins in same PDB: d4p4ka1, d4p4kc2, d4p4kd2, d4p4ke1, d4p4kh2
   automated match to d1muja1
   complexed with 0be, na, nag

Details for d4p4ke2

PDB Entry: 4p4k, 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity

PDB Compounds: (E:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p4ke2:

Sequence; same for both SEQRES and ATOM records:

>d4p4ke2 b.1.1.0 (E:84-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndppevtvfpkepvelgqpntlichidkffppvlnvtwlcngelvtegvaeslflprtdy
sfhkfhyltfvpsaedfydcrvehwgldqpllkhweaq

Timeline for d4p4ke2:

• d4p4ke2 is new in SCOPe 2.04-stable
  
• d4p4ke2 appears in SCOPe 2.05
  
• d4p4ke2 appears in the current release, SCOPe 2.08