Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d4ocyl1: 4ocy L:1-112 [258028] Other proteins in same PDB: d4ocyl2 automated match to d2ok0l1 |
PDB Entry: 4ocy (more details), 2.79 Å
SCOPe Domain Sequences for d4ocyl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ocyl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvlltqiplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvstrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtqlelk
Timeline for d4ocyl1: