SCOPe 2.08: Domain d4o9sa_: 4o9s A:

Lineage for d4o9sa_ (4o9s A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries)

8. Domain d4o9sa_: 4o9s A: [258024]
   automated match to d1qabe_
   complexed with 2ry, cl, edo, peg

Details for d4o9sa_

PDB Entry: 4o9s, 2.3 Å

PDB Description: crystal structure of retinol-binding protein 4 (rbp4)in complex with a non-retinoid ligand

PDB Compounds: (A:) retinol-binding protein 4

SCOPe Domain Sequences for d4o9sa_:

Sequence; same for both SEQRES and ATOM records:

>d4o9sa_ b.60.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd

Timeline for d4o9sa_:

• d4o9sa_ first appeared in SCOPe 2.04
  
• d4o9sa_ appears in SCOPe 2.07