Lineage for d4nzbn_ (4nzb N:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819478Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2819479Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2819559Domain d4nzbn_: 4nzb N: [258017]
    automated match to d1uv6a_
    complexed with 1pe, act, cl, gol, nag, nse, so4

Details for d4nzbn_

PDB Entry: 4nzb (more details), 2.68 Å

PDB Description: ns9283 bound to ls-achbp
PDB Compounds: (N:) acetylcholine-binding protein

SCOPe Domain Sequences for d4nzbn_:

Sequence, based on SEQRES records: (download)

>d4nzbn_ b.96.1.1 (N:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4nzbn_ b.96.1.1 (N:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtys
ccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4nzbn_:

Click to download the PDB-style file with coordinates for d4nzbn_.
(The format of our PDB-style files is described here.)

Timeline for d4nzbn_: