Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (13 proteins) |
Protein alpha-Lytic protease [50498] (1 species) |
Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (39 PDB entries) |
Domain d1p10a_: 1p10 A: [25801] complexed with b2v, so4; mutant |
PDB Entry: 1p10 (more details), 2.25 Å
SCOP Domain Sequences for d1p10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p10a_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495} anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl ferlqpilsqyglslvtg
Timeline for d1p10a_: