Lineage for d4nsyb_ (4nsy B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545312Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1545508Protein automated matches [190306] (4 species)
    not a true protein
  7. 1545536Species Lysobacter enzymogenes [TaxId:69] [189631] (4 PDB entries)
  8. 1545541Domain d4nsyb_: 4nsy B: [257996]
    automated match to d1arba_
    complexed with 2oy, ca, cl

Details for d4nsyb_

PDB Entry: 4nsy (more details), 1.1 Å

PDB Description: wild-type lysobacter enzymogenes lysc endoproteinase covalently inhibited by tlck
PDB Compounds: (B:) Lysyl endopeptidase

SCOPe Domain Sequences for d4nsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nsyb_ b.47.1.1 (B:) automated matches {Lysobacter enzymogenes [TaxId: 69]}
gvsgscnidvvcpegnghrdvirsvaayskqgtmwctgslvnnsandkkmyfltanhcgm
ttaaiassmvvywnyqnstcrapgssssgangdgslaqsqtgavvratnaasdftlleln
taanpaynlfwagwdrrdqnfagataihhpnvaekrishstvateisgyngatgtshlhv
fwqasggvtepgssgspiyspekrvlgqlhggpsscsatgadrsdyygrvftswtgggts
atrlsdwldaagtgaqfidgldstg

SCOPe Domain Coordinates for d4nsyb_:

Click to download the PDB-style file with coordinates for d4nsyb_.
(The format of our PDB-style files is described here.)

Timeline for d4nsyb_: