Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
Species Escherichia coli [TaxId:562] [51212] (30 PDB entries) |
Domain d4n9ha1: 4n9h A:9-137 [257974] Other proteins in same PDB: d4n9ha2, d4n9hb2 automated match to d1g6nb2 |
PDB Entry: 4n9h (more details), 2.2 Å
SCOPe Domain Sequences for d4n9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n9ha1 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts ekvgnlafl
Timeline for d4n9ha1: