Lineage for d4n3zb_ (4n3z B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709289Superfamily h.1.27: G protein-binding domain [103652] (2 families) (S)
  5. 1709298Family h.1.27.2: Rabaptin-5 [118367] (2 proteins)
  6. 1709308Protein automated matches [257967] (1 species)
    not a true protein
  7. 1709309Species Homo sapiens [TaxId:9606] [257968] (1 PDB entry)
  8. 1709310Domain d4n3zb_: 4n3z B: [257970]
    automated match to d1x79b_
    complexed with po4

Details for d4n3zb_

PDB Entry: 4n3z (more details), 3.1 Å

PDB Description: crystal structure of rabex-5delta and rabaptin-5c21 complex
PDB Compounds: (B:) Rab GTPase-binding effector protein 1

SCOPe Domain Sequences for d4n3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n3zb_ h.1.27.2 (B:) automated matches {Homo sapiens [TaxId: 9606]}
trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee
lqqglsqakrdvqeqmavlmqs

SCOPe Domain Coordinates for d4n3zb_:

Click to download the PDB-style file with coordinates for d4n3zb_.
(The format of our PDB-style files is described here.)

Timeline for d4n3zb_: