Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.27: G protein-binding domain [103652] (2 families) |
Family h.1.27.2: Rabaptin-5 [118367] (2 proteins) |
Protein automated matches [257967] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [257968] (1 PDB entry) |
Domain d4n3zb_: 4n3z B: [257970] automated match to d1x79b_ complexed with po4 |
PDB Entry: 4n3z (more details), 3.1 Å
SCOPe Domain Sequences for d4n3zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n3zb_ h.1.27.2 (B:) automated matches {Homo sapiens [TaxId: 9606]} trdqvkklqlmlrqandqlektmkdkqeledfikqssedsshqisalvlraqaseillee lqqglsqakrdvqeqmavlmqs
Timeline for d4n3zb_: