Lineage for d8lpra_ (8lpr A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14825Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins)
  6. 14830Protein alpha-Lytic protease [50498] (1 species)
  7. 14831Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (38 PDB entries)
  8. 14862Domain d8lpra_: 8lpr A: [25796]

Details for d8lpra_

PDB Entry: 8lpr (more details), 2.25 Å

PDB Description: structural basis for broad specificity in alpha-lytic protease mutants

SCOP Domain Sequences for d8lpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8lpra_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOP Domain Coordinates for d8lpra_:

Click to download the PDB-style file with coordinates for d8lpra_.
(The format of our PDB-style files is described here.)

Timeline for d8lpra_: