SCOPe 2.07: Domain d2mklc1: 2mkl C:3-105

Lineage for d2mklc1 (2mkl C:3-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries)

8. Domain d2mklc1: 2mkl C:3-105 [257941]
   Other proteins in same PDB: d2mklc2
   automated match to d3dj9a_

Details for d2mklc1

PDB Entry: 2mkl

PDB Description: Solution structure of the fourth constant immunoglobulin domain of nurse shark IgNAR

PDB Compounds: (C:) novel antigen receptor

SCOPe Domain Sequences for d2mklc1:

Sequence; same for both SEQRES and ATOM records:

>d2mklc1 b.1.1.0 (C:3-105) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rqtdisvsllkppfeeiwtqqtativceivysdlenikvfwqvngverkkgvetqnpews
gskstivsklkvmasewdsgteyvclvedselptpvkasirka

Timeline for d2mklc1:

• d2mklc1 first appeared in SCOPe 2.04, called d2mklc_
  
• d2mklc1 appears in SCOPe 2.06
  
• d2mklc1 appears in the current release, SCOPe 2.08