SCOPe 2.04: Domain d2mklc_: 2mkl C:

Lineage for d2mklc_ (2mkl C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Ginglymostoma cirratum [TaxId:7801] [257940] (4 PDB entries)

8. Domain d2mklc_: 2mkl C: [257941]
   automated match to d3dj9a_

Details for d2mklc_

PDB Entry: 2mkl

PDB Description: Solution structure of the fourth constant immunoglobulin domain of nurse shark IgNAR

PDB Compounds: (C:) novel antigen receptor

SCOPe Domain Sequences for d2mklc_:

Sequence; same for both SEQRES and ATOM records:

>d2mklc_ b.1.1.0 (C:) automated matches {Ginglymostoma cirratum [TaxId: 7801]}
mgrqtdisvsllkppfeeiwtqqtativceivysdlenikvfwqvngverkkgvetqnpe
wsgskstivsklkvmasewdsgteyvclvedselptpvkasirka

Timeline for d2mklc_:

• d2mklc_ is new in SCOPe 2.04-stable
  
• d2mklc_ appears in SCOPe 2.05
  
• d2mklc_ appears in the current release, SCOPe 2.08, called d2mklc1