SCOP 1.67: Domain d1gbla_: 1gbl A:

Lineage for d1gbla_ (1gbl A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (13 proteins)

6. Protein alpha-Lytic protease [50498] (1 species)

7. Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (39 PDB entries)

8. Domain d1gbla_: 1gbl A: [25794]
   complexed with ble, so4; mutant

Details for d1gbla_

PDB Entry: 1gbl, 2.15 Å

PDB Description: alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid

SCOP Domain Sequences for d1gbla_:

Sequence; same for both SEQRES and ATOM records:

>d1gbla_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d1gbla_:

• d1gbla_ first appeared (with stable ids) in SCOP 1.55
  
• d1gbla_ appears in SCOP 1.65
  
• d1gbla_ appears in SCOP 1.69
  
• d1gbla_ appears in the current release, SCOPe 2.08